Protein Info for DVU1329 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpoA
Annotation: DNA-directed RNA polymerase, alpha subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 35 to 327 (293 residues), 373.4 bits, see alignment E=3.7e-116 PF01193: RNA_pol_L" amino acids 41 to 235 (195 residues), 85.7 bits, see alignment E=2.1e-28 PF01000: RNA_pol_A_bac" amino acids 71 to 186 (116 residues), 108.2 bits, see alignment E=4.6e-35 PF03118: RNA_pol_A_CTD" amino acids 261 to 319 (59 residues), 92.6 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 100% identical to RPOA_DESVH: DNA-directed RNA polymerase subunit alpha (rpoA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 100% identity to dvl:Dvul_1739)

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CF4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>DVU1329 DNA-directed RNA polymerase, alpha subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLIKQGDRLINTRNWSELVKPEQISRDGEVSDTMYGKFVCEPLERGYATTIGNAMRRVLL
SSLQGAAFVAVKISGVQHEFTTIPGVLEDVTDVVLNLKQVRLAMDTEEPQYLELKVDKRG
AITAGDVRTNQHVMVLNPDQHIATLTEDIELTFELEVRMGKGYVPADMHEGLSEEIGLIK
LDASFSPVRKVAYTVEQARVGQMTNYDKLILEVWTDGSVSPEDAIAYSAKIIKDQISVFI
NFDERISGENSNGSADSGEFNEHLFKSIDELELSVRATNCLKSANIALVGELVQKSENEM
LKTKNFGRKSLDEIRRVLGDMGLDFGTKVDGFEKKYQEWKRKQQHEA