Protein Info for DVU1326 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpsM
Annotation: ribosomal protein S13 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03631: ribosomal protein uS13
  • amino acids 3 to 115 (113 residues), 179.2 bits, E=1.4e-57
• PF00416: Ribosomal_S13
  • amino acids 3 to 109 (107 residues), 112.3 bits, E=1.1e-36

Best Hits

Swiss-Prot: 100% identical to RS13_DESVH: 30S ribosomal protein S13 (rpsM) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 100% identity to dvl:Dvul_1742)

MetaCyc: 59% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

See Q72CF7 at UniProt or InterPro

Protein Sequence (122 amino acids)

>DVU1326 ribosomal protein S13 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARIAGVDLPRGKRVDIALTYIYGIGRATALQILDATGVNWTRNVDDLNADEVNEIRKEI
EQNHKVEGDLRREISANIKRLMDIGCYRGLRHRRGLPVRGQRTHTNARTRKGPRRGTVGK
KK