Protein Info for DVU1324 in Desulfovibrio vulgaris Hildenborough JW710

Name: map
Annotation: methionine aminopeptidase, type I (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00500: methionine aminopeptidase, type I" amino acids 7 to 252 (246 residues), 313.6 bits, see alignment E=4.6e-98 PF00557: Peptidase_M24" amino acids 17 to 245 (229 residues), 181.7 bits, see alignment E=8e-58

Best Hits

Swiss-Prot: 55% identical to MAP1_CLOPE: Methionine aminopeptidase (map) from Clostridium perfringens (strain 13 / Type A)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to dvl:Dvul_1744)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CF9 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DVU1324 methionine aminopeptidase, type I (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKKYRGIFIKNENEIGLLREANRIVASILDVLGEHVRPGVRTMHFEELAQKLCQEHGVKP
AFQGYYGYPFALCCSVNEEVVHGFPSERILNEGDIVSFDMGVVYEGFYGDSARTFPVGKV
SDEATRLMDVTRESLMKGIAQAKPGNSLYDISVAVQRHVESNGFQVVRRFVGHGIGRALH
EKPEVPNFVPPGITGVPLKPGMVLAIEPMVTVGTYEVEILDDNWTAVTRDRKLSAHFEHS
VAITNDGCEILSLSPGAVR