Protein Info for DVU1300 in Desulfovibrio vulgaris Hildenborough JW710

Name: fusA-1
Annotation: translation elongation factor G (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 TIGR00484: translation elongation factor G" amino acids 1 to 690 (690 residues), 1132.7 bits, see alignment E=0 TIGR00231: small GTP-binding protein domain" amino acids 10 to 179 (170 residues), 123.2 bits, see alignment E=8.8e-40 PF00009: GTP_EFTU" amino acids 11 to 281 (271 residues), 226.7 bits, see alignment E=4.5e-71 PF03144: GTP_EFTU_D2" amino acids 324 to 391 (68 residues), 64 bits, see alignment E=3.6e-21 PF14492: EFG_III" amino acids 404 to 478 (75 residues), 110.4 bits, see alignment E=9.1e-36 PF03764: EFG_IV" amino acids 479 to 596 (118 residues), 151 bits, see alignment E=3.2e-48 PF00679: EFG_C" amino acids 599 to 685 (87 residues), 107.6 bits, see alignment E=6.7e-35

Best Hits

Swiss-Prot: 100% identical to EFG_DESVV: Elongation factor G (fusA) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to dvl:Dvul_1768)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CI3 at UniProt or InterPro

Protein Sequence (691 amino acids)

>DVU1300 translation elongation factor G (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARVVPIDMQRNIGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGAATMDWMEQEQERG
ITITSAATTCFWREHRVNIIDTPGHVDFTIEVERSLRVLDGAVCVFDAVAGVEPQSETVW
RQADRYGVPRICFVNKMDRIGASFERCVGMIRDRLRAKPIPVQLPIGAEDRFEGVIDLIT
GKAVTFDKASKGQTFNVGDVPAEYRDQYDAMRFEMIEAVAEEDEALMEKYLGGEELTVEE
IISCVRKATIARNIVPVLCGSAFRNMGVQPLLDAVVDFLPSPVDIEQMKGVNPDKEEETI
VCPCDDKEPLAALVFKLFSDPYIGHLSFCRIYSGFIESGMTVLNANTGKRERVGRLLKMH
ANKREEIKWAGAGDIVALVGLKLASTGDTICDEKRPVVLESLDIPEPVIEVAIEPKTKAD
RDALSAALAKLAKEDPSFRVKGDDETNQTLIAGMGELHLEIIVDRLTREFSVNANVGKPQ
VAYRETITKPGKADTKHVKQSGGRGQYGHAVIEIEPNPGKGYEFVNSITGGVIPKEYIAP
IDKGIQDALKSGILSGFPTVDIKVNLVFGSYHDVDSSEQAFYVTGSMAIKEAIAKSGPVL
LEPIMDVEVVTPDEYLGDVMGDLNGRRGKVQSMEARVGAQSIRAQVPLSEMFGYATDLRS
KTQGRATFSMQFHHYERVPAALAEELVKKKG