Protein Info for DVU1273 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: bacterial type II/III secretion system protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 84 to 515 (432 residues), 299.6 bits, see alignment E=2e-93 PF03958: Secretin_N" amino acids 186 to 253 (68 residues), 42.4 bits, see alignment E=6.6e-15 PF00263: Secretin" amino acids 359 to 515 (157 residues), 149.2 bits, see alignment E=8.9e-48

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 100% identity to dvl:Dvul_1791)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CL0 at UniProt or InterPro

Protein Sequence (524 amino acids)

>DVU1273 bacterial type II/III secretion system protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRFTNTILMTTFTALLAVALVAGCASKKKDETDPFFSKWQSLASNSTGFSPPKVVRDVKP
KTLLRQEEVTAKQEEQKRPLPQMPVTLKLHNVDVGVALRSLAAAANTSIIVSPGVKGTAS
INVNRVPWEDVFKGILASNALDFAWRGELIQVMTLADKKAEVERELLETQRMAQQLKGRK
VGPLVTSVIEVRYAEAAELKKNLEGFLSKDEQNKPVGAVVVDTHTNSLIVQAVEDDLSKI
ITLVNNLDKPRAQILLKAHIVEATRDTARDLGIQWGGVGRSGNMGDGNRMWVTPGGSGPT
KPTDPQAGGGVPVIPPGGLSGQGFGMNFPVNKAGKTAMGSLGLMFGTIGGNMLEVQLSAL
QDNGKLNILSSPSISTLDNQMAFTENGEKVPYVSTNAQGDREVKFEDAVLRLEITPHVID
ESNLKLKVQVKKDEVDLTRTVEGNPFIIKKQTETTLIVQDGETVVISGLTKERSSTRRQG
LPYLQDVEGIGALFGNDSKANKLEDVLIFITPAILPYREETSVN