Protein Info for DVU1263 in Desulfovibrio vulgaris Hildenborough JW710

Name: pppA
Annotation: type IV prepilin-like proteins leader peptidase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 131 to 147 (17 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 189 to 220 (32 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details PF06750: A24_N_bact" amino acids 15 to 97 (83 residues), 113.5 bits, see alignment E=3.9e-37 PF01478: Peptidase_A24" amino acids 109 to 214 (106 residues), 58.8 bits, see alignment E=6.4e-20

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 99% identity to dvl:Dvul_1801)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CM0 at UniProt or InterPro

Protein Sequence (267 amino acids)

>DVU1263 type IV prepilin-like proteins leader peptidase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHQLPPELLPWFALVFGLVFGSFYNVCIHRYIAGESIVWPPSRCPKCETRLGIPDLVPVF
SYLFLRGKCRHCGSHISVRYPVVELASGLLAFLLMHRYGLTWPFAVYYVFGSALLVASFI
DFELFILPDPITLGGAVLAPPAAILLLDLPWQASLAGAVVGGGGFWLVAWLFRKLRGVEG
MGLGDVKLMLLIGGLCGASALPLVTIIAGCAALGASLWFLARREKGTDAREVQIPFGPFL
SLGAVMHMLYGPDIIHWWIALVTGRPF