Protein Info for DVU1204 in Desulfovibrio vulgaris Hildenborough JW710
Name: fabF
Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase II (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to FABF_BACSU: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Bacillus subtilis (strain 168)
KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 100% identity to dvl:Dvul_1853)MetaCyc: 56% identical to beta-ketoacyl-acyl carrier protein synthase II (Bacillus subtilis subtilis 168)
Beta-ketoacyl-acyl-carrier-protein synthase II. [EC: 2.3.1.179, 2.3.1.41]
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
- biotin biosynthesis I (13/15 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
- (5Z)-dodecenoate biosynthesis I (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (12/16 steps found)
- cis-vaccenate biosynthesis (4/5 steps found)
- fatty acid elongation -- saturated (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- palmitate biosynthesis III (21/29 steps found)
- (5Z)-dodecenoate biosynthesis II (4/6 steps found)
- stearate biosynthesis IV (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- superpathway of fatty acid biosynthesis initiation (3/5 steps found)
- fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- petroselinate biosynthesis (2/6 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (17/205 steps found)
- superpathway of mycolate biosynthesis (18/239 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.41
Use Curated BLAST to search for 2.3.1.179 or 2.3.1.41
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q72CS9 at UniProt or InterPro
Protein Sequence (415 amino acids)
>DVU1204 3-oxoacyl-(acyl-carrier-protein) synthase II (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MTGKRVVVTGLAALTPLGNDIETSWDNLVAGKSGIGPITRFDATEYASRIAGEVKDFDPE KFMPAKQARRMDRFVQFAVATGKMLVEHSGLVIDESNADRVGVLLGVGLGGLETIEVFHT KLMEAGPNKVSPFMIPMLISNMAPGQVSIFTGARGPNVVMTSACASATHAIGYAFSEIKL GRIDAAITGGVESTITPMGVSGFTALKALSTAHNDSPEKASRPFDKERDGFVLGEGSGML MLESLDSALARGATIYAEVVGFGASGDAYHMTAPHESGDGMALAMRNAVREAGIPVEAVD HINAHATSTHLNDLCETRAIKQVFGQHAYNIAITANKSMTGHLLGAAGGLESVFTVLTLH RGIIPGTINHETPDPECDLNYMTEGSKEMQAHYALCNSFGFGGTNASLLFKRYED