Protein Info for DVU1147 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: alginate o-acetyltransferase AlgI, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 35 to 64 (30 residues), see Phobius details amino acids 77 to 103 (27 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 227 to 253 (27 residues), see Phobius details amino acids 303 to 328 (26 residues), see Phobius details amino acids 349 to 367 (19 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details PF03062: MBOAT" amino acids 142 to 346 (205 residues), 102.8 bits, see alignment E=2.4e-33 PF13813: MBOAT_2" amino acids 257 to 320 (64 residues), 28.6 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1147)

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CY5 at UniProt or InterPro

Protein Sequence (459 amino acids)

>DVU1147 alginate o-acetyltransferase AlgI, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MVFTSLTFIFLILPLFLALDASAKSSRIDIRNAVLLFVSVVFYTWGEGANVFILILMGII
NYIAGEVIHKADNKKPYLILFVTLNLFTLFSYKFLCWVVAAIAPGVQFPNIAMPLGISFF
SFHAMSYLFDIYSGTTKPARNINEFLTYFCMFPHLVAGPIVRFAQVKSDLEKRGPSRELA
IFGAYRFLLGLNKKVLIANTVAPVADTAFLLCKQGELSSPDAWVGILAYAVQIYFDFSGY
SDMAIGLAALAGFHFEENFKRPYSSLTVREFWRRWHISLSTWFRDYLYIPMGGNALGRTR
TYVNLVMVFFLCGLWHGANVTFIVWGLWNGFFLVFERVASKFTSLRMPSPALKVYFVLVT
LIGWVFFRSENITQAMDYIGSMFSSGGSFTLTIYHAGAMGVLAVALMLCAVPDKYIPCPD
SANPDDFFVAPYAAQAVLSFFSVAMLLKNMRNPFIYFNF