Protein Info for DVU1096 in Desulfovibrio vulgaris Hildenborough JW710

Name: argF
Annotation: ornithine carbamoyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to OTC_DESVH: Ornithine carbamoyltransferase (argF) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1096)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
L-citrulline degradation (3/3 steps found)
L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
urea cycle (3/5 steps found)
L-citrulline biosynthesis (5/8 steps found)
superpathway of arginine and polyamine biosynthesis (11/17 steps found)
superpathway of L-citrulline metabolism (7/12 steps found)
L-arginine biosynthesis IV (archaea) (4/9 steps found)
L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D35 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DVU1096 ornithine carbamoyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPKHFTRIRDLGFEGAWKVLERAKEMKDTGYRGRTLEGKVATLIFEKASTRTRISFEVAV
RHLGGTTIFMTPAESQLGRSEPLRDTARVISRYTDCMIVRTFGQAKIDELASFGSIPVVN
ALTDEGHPCQVMSDVLTMYERTPDLSQVRVAWIGDGNNMANSWIEAAMYFPFELFMAFPE
GYEPDRQLLGLALEAGAKIFLTRDPHMAIDGAHYVNTDVWASMGQEEEQKRREAAFKGFC
IDGALMGRAHPDAKFMHCLPAHRGEEVTDEVMESPASIVWDQAENRLHMQKAILEWVFTE