Protein Info for DVU1085 in Desulfovibrio vulgaris Hildenborough JW710

Name: phoU
Annotation: phosphate transport system protein PhoU (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 4 to 212 (209 residues), 229.8 bits, see alignment E=1.4e-72 PF01895: PhoU" amino acids 16 to 103 (88 residues), 74.1 bits, see alignment E=4.9e-25 amino acids 120 to 204 (85 residues), 61.2 bits, see alignment E=5e-21

Best Hits

KEGG orthology group: K02039, phosphate transport system protein (inferred from 100% identity to dvl:Dvul_1909)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D45 at UniProt or InterPro

Protein Sequence (221 amino acids)

>DVU1085 phosphate transport system protein PhoU (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
METHFHRELQKLRLTILEMAAHATTAIEDATTALIRRDVDLASKVVAGDRHINALECDVD
ERSLRLIALDQPMAVDLRSIVATMRLSMDLERIGDESSNIARYARFLAERPKLSGLEGLE
QLTGHAVGMARKAIDSFRNGDPGSAREVLVLDRRCNEIERETRAGFMEMMRKDGDTVERA
LHAIFAARSLERVGDLSTNIAESVIFIEEGLNIKHSCPQKV