Protein Info for DVU1084 in Desulfovibrio vulgaris Hildenborough JW710

Name: pstB-1
Annotation: phosphate ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 9 to 255 (247 residues), 414.6 bits, see alignment E=6e-129 PF00005: ABC_tran" amino acids 24 to 179 (156 residues), 115.7 bits, see alignment E=4e-37

Best Hits

Swiss-Prot: 100% identical to PSTB_DESVH: Phosphate import ATP-binding protein PstB (pstB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to dvu:DVU1084)

MetaCyc: 58% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D46 at UniProt or InterPro

Protein Sequence (255 amino acids)

>DVU1084 phosphate ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAVTSKAKMYAQGLQFYYGDFKALHDIDLTFEQNQVTALIGPSGCGKSTFLRCLNRMNDL
IPISRVEGVIALDGENIYDPKVDVVELRRRVGMVFQKPNPFPKTVFENVAYGLRVNGVKD
REYLEEKVEQSLRHAALWDEVKDRLQDSALGLSGGQQQRLCIARALAVEPEVLLMDEPAS
ALDPIATQKIEELIHILKQQYTIIIVTHSMQQAARVSDVTAFFYMGRLIETGATEIMFTR
PRNKQTEDYITGRFG