Protein Info for DVU1077 in Desulfovibrio vulgaris Hildenborough JW710

Name: yidC
Annotation: inner membrane protein, 60 kDa (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 322 to 340 (19 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details amino acids 464 to 481 (18 residues), see Phobius details amino acids 493 to 517 (25 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 3 to 344 (342 residues), 233.3 bits, see alignment E=6.6e-73 PF14849: YidC_periplas" amino acids 72 to 335 (264 residues), 159.3 bits, see alignment E=2.1e-50 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 345 to 531 (187 residues), 237.6 bits, see alignment E=1.2e-74 PF02096: 60KD_IMP" amino acids 346 to 531 (186 residues), 224.2 bits, see alignment E=9.1e-71

Best Hits

Swiss-Prot: 100% identical to YIDC_DESVH: Membrane protein insertase YidC (yidC) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to dvl:Dvul_1917)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D53 at UniProt or InterPro

Protein Sequence (534 amino acids)

>DVU1077 inner membrane protein, 60 kDa (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MENKRAIIAVVLSFIVLVGWGYLSEYMGWTPKSVPATEQKTAASAPAPSVVTSAPEAVTP
APAFSPSTGHEVTVTTPLYKAVLHSGGGVLRQFMLSRYHMGIDRDAAPVNLIESSAIRVA
PLGLLVNGQPSWNTGQWAFEGGDLNLADGQTGTLRFVGSVDGLRVVRELEFHADSYLVTE
KLHLAPEGDAPRTARVGFTLGTTSLTPGESQYNLTRVAWFADGSFSEKSSTGDLEKGVLI
DGSIDWAGVMSNYFLAAVAPKDTRAVLKGKLEGGVYRVAVERPDQMVNPGNSDVIVCNYW
FGPKERDLLNAAPNNLGKAIDLGWFGFIARPLVTLLDFFYKYVGNYGTAIILLTILIKLV
FWPLSHKSYKSMEQMKKLQPMLAKVREKHADDREKMNEEMMRLYKTYKVNPAGGCLPMLV
QIPVFFGLYQALLNAIELRHAPFIAHVPFTDIVWLADLSAKDPFYVTPLVMGATMFLQQK
LTPPAGDPTQAKVMMFMPVVFTFLFLNFPSGLVVYWLCNNVLSIAQQWWILRKA