Protein Info for DVU1069 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: branched chain amino acid ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 282 (266 residues), 128.2 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to dvu:DVU1069)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D60 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DVU1069 branched chain amino acid ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTIEMVIPVLAAAVQCGTPILYATLGEMLTERAGVLNLGVEGMMIIGTFTAFLALHLTGD
PWIAVVVAALCGGALGLVHGIVCLVFQGNQVVSGLALTIFGVGLADYLGTPFVGTVTTGF
TPFSLPVLGDIPVLGEVFFRHDALVNLSYVLPPLFWLFLARTRWGLALRATGEHPAAAAA
AGINPVLVRWAALFAGGALVGIGGAYLSLAYTHLWTNNMTAGRGWIAVALVIFAFWRPGR
AVLGAYLFGGVMAFQLRLQAMGASVPSSLLLMLPYALTIGVLLFSSARGKGRGAPAALGV
NIEPKD