Protein Info for DVU1067 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, Bmp family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02608: Bmp" amino acids 55 to 320 (266 residues), 244.4 bits, see alignment E=7.1e-77

Best Hits

Swiss-Prot: 49% identical to PBP_BRUA2: Purine-binding protein BAB2_0673 (BAB2_0673) from Brucella abortus (strain 2308)

KEGG orthology group: K07335, basic membrane protein A and related proteins (inferred from 100% identity to dvl:Dvul_1927)

Predicted SEED Role

"Nucleoside ABC transporter, periplasmic nucleoside-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D62 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DVU1067 membrane protein, Bmp family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRRIIVLLAAMLVLSGLAGCGDDKKPAQEAPKQEAPKQEAKVEQPAAKAGEDKKLQIGLV
YISPVGDAGWSYSHDQGRKALEEAGGVTTSYVESVPEGPDSERVILNMARKGYDIIFTTS
FGYMDPTIKVASQYPDITFLHCSGYKTAPNVSNYFGRMYQARYLTGMVAGAMTKNNILGY
VGAFPIPEVIRGINAFTLGARAVNPNAQVRVVWTKTWYDPATEKEAAKSLLDVGADVIAQ
HQDSPGPQEAAQERGVYSVGYHTDMSAFAPKAHLTSAVWNWKDFYLDVVKQVRAGTWKSG
SYWPGIESGVVDIAPYGEMVPQDVRARVDAAKADIKSGKLKVFTGPVKDQKGAVRVAEGA
VPTDQDLLGMTWFVEGVIGTTE