Protein Info for DVU1057 in Desulfovibrio vulgaris Hildenborough JW710

Name: nikQ
Annotation: component of nickel ABC transport system (Dmitry Rodionov)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 26 to 54 (29 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details PF02361: CbiQ" amino acids 10 to 215 (206 residues), 107.4 bits, see alignment E=4.3e-35 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 17 to 211 (195 residues), 181.7 bits, see alignment E=7.1e-58

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 100% identity to dvl:Dvul_1937)

Predicted SEED Role

"Transmembrane component NikQ of energizing module of nickel ECF transporter" in subsystem ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D72 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DVU1057 component of nickel ABC transport system (Dmitry Rodionov) (Desulfovibrio vulgaris Hildenborough JW710)
MLDEPFSEGTSYLHRADPRAKVVSAFAFAMLVAPVRSLPMALCAFALALVPVVAAQLPLP
RLVRRLVVINLFILFLWLFLPFATPGETVWSLGPLHATAEGLREAALVTLKSNAIVLALI
GLAATSGITETGHALAAIGAPRKLSLLLLFTWRYLHVIEQEYRRLLTAARVRGFVARTDM
RTYATYANLAGMVLVRSWDRAQRVQQAMRLRGFAGTFHRLYDFSTAPGDRMWACAFIAFT
IAVLVTDIILRHGTPA