Protein Info for DVU1044 in Desulfovibrio vulgaris Hildenborough JW710

Name: guaB
Annotation: inosine-5`-monophosphate dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 8 to 452 (445 residues), 617 bits, see alignment E=1e-189 PF00478: IMPDH" amino acids 8 to 470 (463 residues), 549.1 bits, see alignment E=8e-169 PF00571: CBS" amino acids 93 to 139 (47 residues), 47.6 bits, see alignment 3.3e-16 amino acids 149 to 204 (56 residues), 45.6 bits, see alignment 1.4e-15 PF01645: Glu_synthase" amino acids 284 to 361 (78 residues), 22.8 bits, see alignment E=9.7e-09

Best Hits

Swiss-Prot: 63% identical to IMDH_AQUAE: Inosine-5'-monophosphate dehydrogenase (guaB) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to dvu:DVU1044)

MetaCyc: 58% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D85 at UniProt or InterPro

Protein Sequence (485 amino acids)

>DVU1044 inosine-5`-monophosphate dehydrogenase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSKIVCKALTFDDVLLQPGYSEVTPDQVDVATWLTPSIRLNIPLLSAAMDTVTESGMAIS
MARNGGIGVIHKNVPIHRQRLEVEKVKKSESGMIIDPVTIAPGLTVRQALEVMAEYRVSG
LPVVENDKLVGILTNRDVRFVKDLETTCVSEVMTSKNLVTVPVGTTLEEAKHHLHQHRIE
KLLVVDGNNRLQGLITMKDIDKVVKYPNACKDENGRLRVGAAIGIGRDCEERASELIAAG
VDVLVLDSAHGHSRNVLRAIEMVKTSFPQCQLIAGNVATYEGAKAILKAGADAVKVGIGP
GSICTTRIVAGVGVPQVTAIMEAVKAANEMDRCLIADGGIKFSGDVVKALCVGAHTVMIG
SLFAGTDESPGETILYQGRTYKIYRGMGSIDAMKDGSSDRYFQEKSKKLVPEGIVGRVPV
KGPVADSLYQLIGGLRAGMGYVGAANMEELREKSRFVEISAAGLRESHVHDVIITKEAPN
YRVEN