Protein Info for DVU1037 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: mercuric reductase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 6 to 323 (318 residues), 206.2 bits, see alignment E=3e-64 PF01134: GIDA" amino acids 6 to 65 (60 residues), 26.1 bits, see alignment E=1.8e-09 PF12831: FAD_oxidored" amino acids 6 to 44 (39 residues), 30.9 bits, see alignment 7.3e-11 PF00890: FAD_binding_2" amino acids 6 to 41 (36 residues), 22.4 bits, see alignment 2.6e-08 PF13450: NAD_binding_8" amino acids 9 to 44 (36 residues), 25.8 bits, see alignment 4.2e-09 PF13738: Pyr_redox_3" amino acids 122 to 277 (156 residues), 35.4 bits, see alignment E=3e-12 PF00070: Pyr_redox" amino acids 174 to 251 (78 residues), 70.2 bits, see alignment E=6.8e-23 PF02852: Pyr_redox_dim" amino acids 343 to 447 (105 residues), 96.4 bits, see alignment E=4.8e-31

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 100% identity to dvu:DVU1037)

Predicted SEED Role

"Mercuric ion reductase (EC 1.16.1.1)" in subsystem Mercuric reductase or Mercury resistance operon (EC 1.16.1.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D92 at UniProt or InterPro

Protein Sequence (480 amino acids)

>DVU1037 mercuric reductase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDYDADLLVIGGGAAGLTVAAGAARLGARVVLADRGPTLGGDCLHHGCVPSKTLIASARA
RRTMRDAPRFGLPEVALPPVDFKAVAAHIAGVQSVIQKHDSVERFSGLGVEVRFGDAVFV
DEHTVAVEGRRISARRIVVATGSSPQIPAFPGLADTPYLTNRDIFTLETLPASLIVLGGG
PIAVEMAQAFARLGSRVVLVQRGGHILSREDADMAAVVHEALEQDGVRIMTGATVEVARR
QDAGVVVTVRVGDEHVDVHGERLLVALGRTPNVEGLHLGNAGVVFSERGVPVDARMRTSQ
SHILAAGDVTGAWQFTHAAGYEGSVVVANAVLRLPRKAKYDRMPWCTFTDPELASVGLNE
REAHRQGIGVDVHTESFSSNDRALAEGTACGLLKLVLARGTQRVLGVQIAGPHAGELING
WCMALGGGVRLTTLAGGVMPYPTLGEISRRVAGNIVSEALFSDKVRNVLCTLFRYRGKGC