Protein Info for DVU1036 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 70 to 90 (21 residues), see Phobius details amino acids 116 to 142 (27 residues), see Phobius details amino acids 148 to 176 (29 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details PF09335: VTT_dom" amino acids 134 to 251 (118 residues), 91.5 bits, see alignment E=3.1e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1036)

Predicted SEED Role

"COG0398: uncharacterized membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72D93 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DVU1036 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTSGDSGDMKHGAREAVTVGPGGSAGETDVDTPVRGQATEERIVLPWGTGQTGDEAVSPS
AASGGRGRTFVRVALLGLVGVALAGFWFAGGSDLLTLERLRASHDTLVSIYRESPVASVL
VFSLVYVAATALSFPGAAVLTLGGASVFGFWVSLVAVSFASTVGATLAFMGARYVFRDWV
ARRFMEPMRRVDEGVRKDGLFYLFSLRLVPVVPFFLVNLLMGLTRMPTRTYYWVSQVGML
PGTAVYVYAGQELGRIRTTADIFSPGLVAAFVLLAVFPWMTRSALAWYRARRMD