Protein Info for DVU1028 in Desulfovibrio vulgaris Hildenborough JW710

Name: cmk
Annotation: cytidylate kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR00017: cytidylate kinase" amino acids 14 to 225 (212 residues), 194.7 bits, see alignment E=8.6e-62 PF02224: Cytidylate_kin" amino acids 15 to 227 (213 residues), 203.9 bits, see alignment E=5e-64 PF13207: AAA_17" amino acids 19 to 55 (37 residues), 27.7 bits, see alignment 6.2e-10

Best Hits

Swiss-Prot: 100% identical to KCY_DESVH: Cytidylate kinase (cmk) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 99% identity to dvl:Dvul_1965)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DA1 at UniProt or InterPro

Protein Sequence (232 amino acids)

>DVU1028 cytidylate kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPDTTGGHPAALKVVTLDGPAGVGKTTLARRVADALGIPYLDTGAMFRTMAWRLGPDGPD
LDEALLRDRLAGFVFTLRGRGGASVLSCNGEDIGNEIRTEEVGAMASRIAALPVVRECLK
AAQQRMGAAQPLVVEGRDMGTVVFPGARHKFFLDAAPEIRAMRRYTQLQTMGEAHDLALL
TEQIRSRDEQDRNRAVAPLRPAADAIIVDTGDLDIDGVFGVIMQHIRSRDGL