Protein Info for DVU1027 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 35 to 59 (25 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_1966)

Predicted SEED Role

"FIG00606325: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DA2 at UniProt or InterPro

Protein Sequence (323 amino acids)

>DVU1027 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQEENANDSAEKKSRSFFRLGSLGSMLNEKEQKNLLFYLSIGIIIVEFAVTVGALIYGIA
NAHQQPNGMMRFSFPWAGYLVSVVVAPVVVMLLVNLIGMGFYRAVHGEPVLDEEQMKEMP
QRMRSFFSLVRGAPTIVLLGGVLVLGAVLYYLDGVMTFLLKLGDSVETIAIWGTVGLVVA
WCVSYLARAWFMYKTRHLEEEFAFRREVFEKTGMVILDQKAMLSSEVPGRQGMRELPAGT
VEVLPAGGGAPSAPSGGGADTGLSGADSAQDGATVTIVASDAPAEQGPAPTTAGASADAE
DGDVVDACIVEPASKKADEGTKG