Protein Info for DVU1017 in Desulfovibrio vulgaris Hildenborough JW710

Name: rtxB
Annotation: ABC transporter, ATP-binding protein/permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 transmembrane" amino acids 212 to 233 (22 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 319 to 342 (24 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 427 to 451 (25 residues), see Phobius details amino acids 462 to 486 (25 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 58 to 752 (695 residues), 974.9 bits, see alignment E=1.1e-297 PF00664: ABC_membrane" amino acids 213 to 473 (261 residues), 80.4 bits, see alignment E=1.9e-26 PF00005: ABC_tran" amino acids 541 to 690 (150 residues), 104.8 bits, see alignment E=6e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to dvl:Dvul_1977)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DB2 at UniProt or InterPro

Protein Sequence (776 amino acids)

>DVU1017 ABC transporter, ATP-binding protein/permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSGIDEEHMGGYQGADAGDASGQDRVAASGVASEHYAKNTPVDLPSGVAAGDVDYAPPLM
QCLALLFRLNGKPVSTRYLMSGLPMGATEGPALTAACLRAARVAGMEARVAYKPTLRQIS
PLTLPCIMLLKDEKACILMRIQGEQAEVLFPETGMDAVTVPLSRLAEEYAGYAVFGSPVS
KLDKRASEMRLLKVKRWFWDTLLHFLPIYRHVLLASVVVNLLTVASPLFFMNVYDRVVPN
SATDTLWVLAVGIGIAYICDFVLRNLRSYFVDVAGRNADVVLASRLMQHLMAVRLDNKPD
STGSLANNLREFESLREFFGSTTLLALVDLPFLVLFLFIVALIGGEMIALPAIAIPVVLG
VGMLVQYPFQRVAEAGYKEAMQKNALLVEIINGLETVKASMAEGRLQHAWEKVVGMSARS
NAHSKGLANLSITVSLLVTQLVSVGIIIWGVYKISDGTLTMGGLIACNMLSARAMAPLSQ
IAAMLARLQQSRMALKSLDILMQLPVERPEDRPYVDFGPLEHSLELESVSFAYPGAERLA
LDGVSLRIRPGEKVGVIGKMGSGKSTLGRLMMGLYQPRDGAVKFGGVDIRQMDMADLRGR
IGYLSQDNYLFYGTLRDNIAMGVPNADDRMIMRAADVAGVTEFARNHPAGFGLQVGERGM
ALSGGQRQAVALARALLHDPDVLILDEPTSNMDTGSEFAFKQRLRALLGDKTLVLITHRM
SVIDLVDRLVVVDGGRIVADGPRDAVIKALRSTGVQAAPAARFRKNGTVGAAGGAA