Protein Info for DVU0959 in Desulfovibrio vulgaris Hildenborough JW710

Name: dnaB
Annotation: replicative DNA helicase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00772: DnaB" amino acids 47 to 148 (102 residues), 117.5 bits, see alignment E=4e-38 TIGR00665: replicative DNA helicase" amino acids 47 to 480 (434 residues), 585.3 bits, see alignment E=3.6e-180 PF03796: DnaB_C" amino acids 222 to 478 (257 residues), 376.3 bits, see alignment E=1.1e-116 PF13481: AAA_25" amino acids 240 to 400 (161 residues), 37.9 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 48% identical to DNAC_BACSU: Replicative DNA helicase (dnaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to dvu:DVU0959)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DH0 at UniProt or InterPro

Protein Sequence (493 amino acids)

>DVU0959 replicative DNA helicase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSLNQPRPKSRKPQQNNYSSETTPAYGGGGADGAAERASAELLRRVPPHSIEAEQAVLGG
VFLKNSILHTLVDTLTAEDFYLPAHQMLFESFLELYRKNAPIDLVSVAEHLKAHGNLEAV
GGAIYLAELAQAVVSAANAEYYGTIVRDKSLQRSLISACSDIISNCFDASREVGSLLDES
EQAVFAISERTSGKVFRSSKELVKKVFEELEKRVERKELVTGVTTGYVKLDQMTSGFQGS
DLIIVAARPSMGKTAFSLNMAMRAAINQNVPVAVYSLEMSMEQLMMRMLCSFGKVDLSKL
RKGFLDDEDWKRLYEAADVLERAPIYIDDTPALTTLELRARTRRLRAERGVGLVMVDYLQ
LMRSSRRTDSRELEISDISRSLKALAKELNIPVIALSQLNRKVEERTNKRPMLSDLRESG
AIEQDADIIMFIYRDDAYNKRDDNPRKGIAEIIIGKQRNGPTGTAELAYLSAHTAFEDLD
PNWVPPPSEDYGE