Protein Info for DVU0956 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpsF
Annotation: ribosomal protein S6 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR00166: ribosomal protein bS6" amino acids 1 to 93 (93 residues), 66.9 bits, see alignment E=7.2e-23 PF01250: Ribosomal_S6" amino acids 3 to 92 (90 residues), 85.7 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 100% identical to RS6_DESVH: 30S ribosomal protein S6 (rpsF) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02990, small subunit ribosomal protein S6 (inferred from 100% identity to dvu:DVU0956)

Predicted SEED Role

"SSU ribosomal protein S6p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DH3 at UniProt or InterPro

Protein Sequence (101 amino acids)

>DVU0956 ribosomal protein S6 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRKFETLLLLSPELAADAREALLTTLSGVVEREQGSMITADHWGMRDLAYPVRKQMRGYY
VRLEYTAPGATVAELERIIRISDGIFKFVTVKLADAVEEVA