Protein Info for DVU0946 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 99.5 bits, see alignment E=4e-32 PF00158: Sigma54_activat" amino acids 147 to 313 (167 residues), 229.8 bits, see alignment E=4.8e-72 PF14532: Sigma54_activ_2" amino acids 148 to 318 (171 residues), 78.7 bits, see alignment E=1.6e-25 PF07728: AAA_5" amino acids 171 to 289 (119 residues), 29.7 bits, see alignment E=1.8e-10 PF02954: HTH_8" amino acids 425 to 458 (34 residues), 27.4 bits, see alignment (E = 6.6e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2039)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DI3 at UniProt or InterPro

Protein Sequence (476 amino acids)

>DVU0946 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MANRQRVLLVDDEQDFANGLARLIARLFPDVHVDVAFSGQDALEHIRKQRVHVMVTDLRM
PGMGGMELLRRVMETEPDVSVVVLTAHGTIETAVEALQAGAYDFVTKPVEPEQVARVLRK
GLERARLLDENRRLRDLVALVGESGELVGESPAMQSVRRTVATVAPSDYTVLIRGESGTG
KEMVARMVHRLSPRVDEPFLALNCPAIPEHLLESELFGHVRGAFTGAERDRKGLFSIADG
GTVLLDEIGDISSNIQTKLLRFLQEGEVRPVGSPRNEHVDVRIIASTNQDLEARMASRDF
REDLFYRLNVVTIWVPPLRERLSDIPLLAATFLARASRELGVPQRDFDEGVLDHLMRREW
PGNVRELQNYVRRLALFSRGDGITLDAVQQAEQSESGAPAALCVPSPVAEGEVMPYKDAK
ASLVESFSERYLRDLLESTGGNVTEAARLSGLSRVSIQKMVARYGIDAAAMRANGS