Protein Info for DVU0943 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 435 to 454 (20 residues), see Phobius details amino acids 475 to 495 (21 residues), see Phobius details amino acids 515 to 534 (20 residues), see Phobius details amino acids 546 to 572 (27 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 228 to 548 (321 residues), 146.6 bits, see alignment E=4e-47

Best Hits

Swiss-Prot: 100% identical to Y943_DESVH: UPF0324 membrane protein DVU_0943 (DVU_0943) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2042)

Predicted SEED Role

"FIG00602363: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DI6 at UniProt or InterPro

Protein Sequence (579 amino acids)

>DVU0943 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAENESNVVVDHGQSRLSDLWTKEDYWAIWLGFVILIAGMWLFLANPSPEFAQKVDKANA
VMAAEAERAPFKTLAYYKAQDDKGKLKAMDSATGKSIGAFLKAPGGWTSNPLESFVLSKE
AAEERNAAAKSKFEAAKAKSDAAFAAAQVAEAAAAEAGFADTALNDAAQGKIAEWRADLA
KMKSAEKKVKTKAFNISTSLPMLMVVMGLFFAIGMKFMGHDVPKFLVGFIGVFVVAVIAQ
MMGHQSTMKYWGIGTEAWAIIIGMLIANTVGTPNFIKPALQVEYYIKTGLVLLGAEVLFD
KIIAIGIPGIFVAWVVTPIVLICTFIFGQKILKMPSKTLNMVISADMSVCGTSAAIATAA
ACRAKKEELTLSIGLSLVFTAIMMIVMPAFIKSVGMPQILGGAWMGGTIDATGAVAAAGA
FLGEKALYVAATIKMIQNVLIGVVAFGVAVYWCARVECTSGRSVGWIEIWNRFPKFVLGF
LTASIIFSIISGSLGSDMSQIMVNQGVLKGLSSPLRGWFFCLAFTAIGLATNFRELAHYF
KGGKPLILYVCGQSFNLVLTLTMAYIMFYIVFPEITAKI