Protein Info for DVU0924 in Desulfovibrio vulgaris Hildenborough JW710

Name: rumA
Annotation: 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 6 to 59 (54 residues), 30.1 bits, 1.2e-10
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 20 to 450 (431 residues), 321.1 bits, E=5.6e-100
• PF05958: tRNA_U5-meth_tr
  • amino acids 281 to 457 (177 residues), 68.2 bits, E=2.4e-22
• PF05175: MTS
  • amino acids 294 to 409 (116 residues), 27.1 bits, E=9.8e-10
• PF13847: Methyltransf_31
  • amino acids 311 to 372 (62 residues), 27.2 bits, E=1e-09
• PF09445: Methyltransf_15
  • amino acids 312 to 395 (84 residues), 22.6 bits, E=2.4e-08
• PF13649: Methyltransf_25
  • amino acids 313 to 369 (57 residues), 30.8 bits, 1.4e-10
• PF08241: Methyltransf_11
  • amino acids 315 to 369 (55 residues), 22.3 bits, 6.1e-08

Best Hits

Swiss-Prot: 100% identical to Y924_DESVH: Uncharacterized RNA methyltransferase DVU_0924 (DVU_0924) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to dvu:DVU0924)

Predicted SEED Role

"RNA methyltransferase, TrmA family"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q72DK5 at UniProt or InterPro

Protein Sequence (468 amino acids)

>DVU0924 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
METFANGMTLDVTVDALAPGGKAVCRHEGRVIFVDRGLPGQQLHVRLTTVRKRFAEAECL
AVVTHTADECDPFCPHFGDCGGCTWQNLPYPAQLAWKERFVRDSLQRIGRIEAPNVLPTL
PSPLQQGFRNKMEFAFTTDDREMLHLGLRRRGGHEVVDVTSCGLQTATTCRVVTTARDIA
RASGLPGWDDAAHRGFWRFLVVREPARGGQCLVQCITAPHPEAEHVARAFFTALRQAVPE
VTGCVHSIRSQNSQVAYGDATVFTEGEIVLTEKLGAIELDFGHDTFLQTNTRATELLYGE
VERMAGLSGREHVWDLYCGVGSIALWLAEHAATICGMEATPASVEAAQRNAQAAGCTHCD
FVAGDVRALLRSRSKGKAQEPIPDVVVTDPPRAGMHPDVIDALLQTAPARIVYVSCDPAT
MARDVGLLMQRYTLHEARPVDLFPHTPHVETVVLLSNKEVDDTISTTV