Protein Info for DVU0919 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details PF03899: ATP-synt_I" amino acids 26 to 122 (97 residues), 41.1 bits, see alignment E=1e-14

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_2065)

Predicted SEED Role

"FIG048548: ATP synthase protein I2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DL0 at UniProt or InterPro

Protein Sequence (144 amino acids)

>DVU0919 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLRSSVRRIDEMLWRRGFRAQEVRVVLRNQLLVTAVSLLAGLGLGWINGWLFWFGVGAVL
STFNFYAVAKFVQQVVYKPYDRSMMYGMLFRFYGRLGLTGLILFGLIVWLKVSVSALVAG
LSTIVAAIAVWGLLRLAGQNVKEA