Protein Info for DVU0888 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 PF00072: Response_reg" amino acids 73 to 175 (103 residues), 81.4 bits, see alignment E=2.8e-26 TIGR00229: PAS domain S-box protein" amino acids 237 to 363 (127 residues), 46.5 bits, see alignment E=1.9e-16 PF00989: PAS" amino acids 241 to 354 (114 residues), 29.9 bits, see alignment E=2.4e-10 PF13426: PAS_9" amino acids 262 to 356 (95 residues), 31 bits, see alignment E=1.3e-10 PF08448: PAS_4" amino acids 262 to 359 (98 residues), 29.2 bits, see alignment E=4.7e-10 PF08447: PAS_3" amino acids 264 to 351 (88 residues), 35.7 bits, see alignment E=4.3e-12 PF07568: HisKA_2" amino acids 377 to 451 (75 residues), 93.5 bits, see alignment E=3.5e-30 PF07536: HWE_HK" amino acids 377 to 441 (65 residues), 25.5 bits, see alignment E=9e-09 PF13581: HATPase_c_2" amino acids 476 to 553 (78 residues), 28.3 bits, see alignment E=7.6e-10 PF02518: HATPase_c" amino acids 479 to 567 (89 residues), 43.8 bits, see alignment E=1.6e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0888)

Predicted SEED Role

"Sensory transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DP1 at UniProt or InterPro

Protein Sequence (570 amino acids)

>DVU0888 response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMAATGGRIPCSGFREPGVFSGVPRPRCTFESGLGGMGTGQSESMRCVAMARGGGVRSGA
RRESVSGVRMYRILIADDEPVVRYTLALYLEDAGYRVLQAGTVREALDLFDAEGADIAFI
DWHMPGGGGAEALPLFASRAPTLPVVVVSGTNNVSDVIRALQLGAWDFMTKPIVDLAMVE
QTLERCLVRARLLRDEGRLREHLEEQVLQRSRELEEANAQLRREIAERRDFEAALGESEA
RFRQLVENIHELFWVRDVFTWRLLYISPACETLFGVSPKQVIEKPELLHHFLAQSNREKF
VEELLQTVRAGDVFDAEVQAWGAHGDDMVLRVRAFPVRDAAGHIYRVAGVAEDVTQRRQA
ERRILTSLREKEILLKEVHHRVKNNLQLVVSLLNLQASSVYDVRDRALLLDSRNRIASMA
LVHEELYRSDDLSGVDFADYLPRLARKLQSAFVIDVELDLQLDVAPVMLPVDIAIPCGLI
LNELIANALKHAFAERGHGRLSVSLQCQGGRAVLAVADDGVGLPAPFEALGERTLGVQLV
RSLVQQLGGELRQQPGPGAHIVISFPVGEV