Protein Info for DVU0881 in Desulfovibrio vulgaris Hildenborough JW710

Name: fusA
Annotation: translation elongation factor G, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 PF00009: GTP_EFTU" amino acids 9 to 276 (268 residues), 103.1 bits, see alignment E=3.6e-33 PF22042: EF-G_D2" amino acids 298 to 382 (85 residues), 54.7 bits, see alignment E=2.2e-18 PF14492: EFG_III" amino acids 394 to 467 (74 residues), 73.2 bits, see alignment E=3.7e-24 PF03764: EFG_IV" amino acids 469 to 586 (118 residues), 147.4 bits, see alignment E=4.3e-47 PF00679: EFG_C" amino acids 590 to 676 (87 residues), 93.5 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 44% identical to EFG_MOOTA: Elongation factor G (fusA) from Moorella thermoacetica (strain ATCC 39073 / JCM 9320)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to dvu:DVU0881)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DP8 at UniProt or InterPro

Protein Sequence (688 amino acids)

>DVU0881 translation elongation factor G, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSKALETQRTYALVGTGGCGKTSLAEMLLYRAGVVNRLGRSEEGTTTLDYEPEEVKRRGS
IQPAFATWLWNRNRHFLVDIPGDTNFIGDIGYLLTGVDAAVFVIDAVDGVRPLTKKLWKA
VRDASLPAIVCINKLDRDRADFNMAFNGLASTLGMKPVLLYVPIGGPSDFRGVVDVMADK
ALMFGENGAVTEAPVPDDLAEEVAILRETTIENIAESDETLMEKYLEEGVLSPDELAAGL
RKGVLSGDLVPVVVAAALEDKGGVQLLDTIDALFPSPLDRPAWVDAEGNERASTDEAPAA
CFVFKTLADPFAGQLNMVRILSGTISTESTLKNMTTGDPERLGSLAFMVGKTQTPCKEAL
GPGAIVAVAKLKGTRTGDTLCDEKAPFVLPKPALPPQLISYALAPKEKGEEDKVFAAMHK
LLDEDVTLRLSRDGESSDILVSGMGQLHIELSVEKARRRYKAEILLKTPKIPYREALRGK
AQVQGRHKKQSGGRGQFGDCWIEIEGLPRGTGYVFEDAIVGGSIPRQYIPAVDKGVQEAA
ARGYLAGFPVVDFKVKLYDGSYHTVDSSEMAFKIAGSIAFKKAMEMVKPVLLEPLVLLTV
SVPDEFMGDVIGDLSSRRGKVLGSDSVAGLTEIKAHVPMSEVLRYAPDLRSMTGGQGLFT
MEFDHYEEAPPPVAEKVIAEHAKERAEA