Protein Info for DVU0876 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: metallo-beta-lactamase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 TIGR00649: beta-CASP ribonuclease, RNase J family" amino acids 9 to 551 (543 residues), 495.1 bits, see alignment E=1.1e-152 PF00753: Lactamase_B" amino acids 28 to 167 (140 residues), 31.4 bits, see alignment E=4.6e-11 PF12706: Lactamase_B_2" amino acids 33 to 169 (137 residues), 41.6 bits, see alignment E=2.6e-14 PF22505: RNase_J_b_CASP" amino acids 225 to 350 (126 residues), 148 bits, see alignment E=2.9e-47 PF07521: RMMBL" amino acids 365 to 409 (45 residues), 47.5 bits, see alignment 3.7e-16 PF17770: RNase_J_C" amino acids 456 to 553 (98 residues), 65.3 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: K07021, (no description) (inferred from 100% identity to dvl:Dvul_2106)

Predicted SEED Role

"Ribonuclease J2 (endoribonuclease in RNA processing)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DQ3 at UniProt or InterPro

Protein Sequence (554 amino acids)

>DVU0876 metallo-beta-lactamase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAEHAPHFTITPLGGLGEIGLNCQVWSTADSTVLIDCGLMFPDDYHLGVDVVIPRFDHIL
QQRDKVRGIILTHGHEDHIGALPWLVPHLRGIPIFGSRFTLALVEHKLREHGLADRVEFV
PVTPGTPLALGDMTFHFLPVCHSIIEGYAVGVETPVGRVLHTGDFKIDPHPLEGSGTDLD
LFRSFAGDEGVRLLLSDSTNIEREGHSLPEREILSSFRHIFTEAQGRIVITLFSSHIQRI
QEVFDLAAEFGRTVVVSGRSLMTNIELAREHGFLRVPPALHMDAAGLPPVADRDMVLLVT
GSQGEPLSALSRITMGEHKHLTIHEGDTVVMSSRIIPGNARAITRLINQIYRLGAEVYYD
KFRAIHASGHAHRDELRAMIETMRPQCFVPVHGEYRHLVKHARLAQECGVAPERAFILEN
GDPLTLLPQGVRLGERIHVESILVDGKGVGDVGHSVLKERHILGGEGMVIVVLVVDEVTW
DVLHGPEMLSKGFVFEQHYNHVLEDAKCIVLDIFENIPPGETERLQDRIRSALRRFFRKV
LERDPIVVPVITTI