Protein Info for DVU0870 in Desulfovibrio vulgaris Hildenborough JW710

Name: frr
Annotation: ribosome recycling factor (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR00496: ribosome recycling factor" amino acids 11 to 186 (176 residues), 249.6 bits, see alignment E=7e-79 PF01765: RRF" amino acids 21 to 184 (164 residues), 239 bits, see alignment E=1.2e-75

Best Hits

Swiss-Prot: 100% identical to RRF_DESVH: Ribosome-recycling factor (frr) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 100% identity to dvl:Dvul_2112)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DQ9 at UniProt or InterPro

Protein Sequence (186 amino acids)

>DVU0870 ribosome recycling factor (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDMDSILLDAEERMEKAIAALEREFSRLRTGRASASLVDGIKVDYYGTPTPISQVASVAV
PDSRCITIQPWDRNAFSLIEKAILKSDLGLNPVNDGKIIRINIPPLTEERRKDLGKMARK
YAEEAKVAVRNVRRDANEQLKKLEKNKELSEDDLRKAQEDVQKLTDRFVAKTDEKAGAKE
KEIMDI