Protein Info for DVU0857 in Desulfovibrio vulgaris Hildenborough JW710

Name: nirJ-1
Annotation: radical SAM domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 TIGR04546: 12,18-didecarboxysiroheme deacetylase" amino acids 2 to 391 (390 residues), 800.3 bits, see alignment E=2.6e-245 PF04055: Radical_SAM" amino acids 45 to 201 (157 residues), 108.1 bits, see alignment E=8.2e-35 PF13353: Fer4_12" amino acids 47 to 149 (103 residues), 40.6 bits, see alignment E=4.8e-14 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 301 to 384 (84 residues), 32.6 bits, see alignment E=8.8e-12 PF13186: SPASM" amino acids 301 to 356 (56 residues), 25.7 bits, see alignment 1.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2126)

MetaCyc: 66% identical to Fe-coproporphyrin synthase (Methanosarcina barkeri)
1.3.99.-

Predicted SEED Role

"Radical SAM domain heme biosynthesis protein" in subsystem Heme biosynthesis orphans

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DS2 at UniProt or InterPro

Protein Sequence (393 amino acids)

>DVU0857 radical SAM domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIGISKLYCGQVEPSDALRYGRNSGQLPSHLLQFSKDKKPVVVWNMTRRCNLKCVHCYAK
AVDPEGKDEISTEQAKTIIDDLAQYGAPVMLFSGGEPLVRQDLVELAKHATGRGMRAVIS
TNGTLITKEKARELKEVGLSYVGISLDGGEEVHDKFRAVPGSYRRALQGIENCKAEGLKV
GLRFTINKRNQSEVPKLFQLLRDLEVPRICFYHLVYSGRGSELIKEDLDHAETRAIVDLI
MDKTRELFDAGLPKEVLTVDNHADGPYVWMRMLREDPKRAEEVFELLQYNEGNNSGRGIG
CISWDGQVHADQFWRNHTFGNVLERPFSEIWDDPNIELLHKLKDKKKHVGGRCATCRYLN
ICGGNFRARAEAYYGDEWAQDPACYLTDDEIRA