Protein Info for DVU0848 in Desulfovibrio vulgaris Hildenborough JW710

Name: QmoA
Annotation: Quinone-interacting membrane-bound oxidoreductase (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12831: FAD_oxidored" amino acids 5 to 41 (37 residues), 35.8 bits, see alignment 2.7e-12 PF00070: Pyr_redox" amino acids 5 to 95 (91 residues), 25.7 bits, see alignment E=6.1e-09 PF00890: FAD_binding_2" amino acids 5 to 40 (36 residues), 29.3 bits, see alignment 2.4e-10 PF01134: GIDA" amino acids 5 to 58 (54 residues), 19.1 bits, see alignment 2.7e-07 PF13450: NAD_binding_8" amino acids 7 to 43 (37 residues), 33.4 bits, see alignment 2e-11

Best Hits

KEGG orthology group: K03388, heterodisulfide reductase subunit A [EC: 1.8.98.1] (inferred from 100% identity to dvl:Dvul_2135)

MetaCyc: 68% identical to QmoA (Desulfovibrio desulfuricans)
RXN-23227

Predicted SEED Role

"heterodisulfide reductase, subunit A/methylviologen reducing hydrogenase, subunit delta" in subsystem Anaerobic respiratory reductases or Hydrogenases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DT1 at UniProt or InterPro

Protein Sequence (412 amino acids)

>DVU0848 Quinone-interacting membrane-bound oxidoreductase (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MSNSILVVGGGFSGLTAAIEAAEVGYEVFIVEKSPFLGGRVAQLNKYFPKLCPPSCGLEI
QFQRIKKNPNIKFFTQAQVTAVKGEKGNYTVSVRIEPRHTVPNSADLSMLAGALEGEVEN
EFELGLAKRKPLYLSTPFAFPNRYVLDKNALSQADQLKVGASAFCDLNEGPREIELSVGS
IVLATGWKPYDVTNLSNLGAGKIANCVSNMQLERLAAACGPTKGAITRPGDGKSPRKIAF
VQCAGSRDQNHLNFCSYICCMASLKQALYVREQYPDAEVTVYYIDLRTPGRYDKFMRKVR
ADEKINLVKGKVAGVEEDTATGDVIVEVEDAVKGEKRKVRYDMVVLATGMQPSLAGQKLP
FDVPVDEDGFIVGGEEKGIFAAGCAQKPLDVMRSAQSGTSAALKAIQTVRGR