Protein Info for DVU0831 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: PTS system, IID component, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 64 to 82 (19 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details PF03613: EIID-AGA" amino acids 6 to 174 (169 residues), 88.7 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: K02796, PTS system, mannose-specific IID component (inferred from 100% identity to dvu:DVU0831)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DU8 at UniProt or InterPro

Protein Sequence (252 amino acids)

>DVU0831 PTS system, IID component, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPDARTLLICLLRTYLIGASFNTRGLQNIGIVYALEPGLRAIHQDPRACRDARKRYLRHF
NTHPFWTPLLVGVFLSLEGNIARKTFPPELLASVKDTTVYTLSAIGDSVFGGSLLVFWSL
VSCTLVVSGHEMAAALFTLSLFLGLQAFKALTFIAGLREGLKVLQRLKQWDLINWGDRIK
MCNGLLLVVLLWRVWPHPAHGLPWGIACIMLSVAALMVGRFHISRIFLAACALAGAYALP
WASDWMLLVPSF