Protein Info for DVU0816 in Desulfovibrio vulgaris Hildenborough JW710

Name: cobQ
Annotation: cobyric acid synthase CobQ (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF13500: AAA_26" amino acids 7 to 234 (228 residues), 44.5 bits, see alignment E=2.6e-15 TIGR00313: cobyric acid synthase CobQ" amino acids 8 to 528 (521 residues), 485.8 bits, see alignment E=7.2e-150 PF01656: CbiA" amino acids 9 to 233 (225 residues), 74.5 bits, see alignment E=1.2e-24 PF07685: GATase_3" amino acids 262 to 481 (220 residues), 158 bits, see alignment E=3.5e-50

Best Hits

Swiss-Prot: 100% identical to COBQ_DESVH: Cobyric acid synthase (cobQ) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to dvu:DVU0816)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DW3 at UniProt or InterPro

Protein Sequence (543 amino acids)

>DVU0816 cobyric acid synthase CobQ (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKSPTPALMLQGTSSNAGKSILTAAFCRILLQDGYRVAPFKAQNMALNSHVTADGLELGR
AQAVQAAACRLDVDVRMNPVLLKPNSDTGSQVVVMGRPVGNMRVREYMAYKPVAFDAARA
AYDSLAADVDVMVLEGAGSPAEVNLKAHDIVNMAMARHAEAKVLLVGDIDRGGVFASLVG
TMELLDPWERDLVAGFVLNKFRGDATLLSPAYDVVTGRTGKPFLGVVPWLHDLGLPDEDS
VSFRETLAGRAPDVPAGGGMLDIVLVDLPHISNFTDLDALRREPDVAVRVVRSPEQLGSP
DAIILPGSKNTLGDLAALRSRGMAEALCALRSAEGGHLGPVIVGICGGFQMMGRFLADPQ
GVESDHACTEAGLGLLPVTTEMGSAKVLRRTSAKTVSGWCGAGVAAGLMPGTGGGHGGAE
VCPGEGYAVHGYEIHHGVTTPDAGGGAVLVCLHESDGSPAGWTTPDGQVWGTYLHGVFDA
DGFRRGWLDALRVRRGLEPVGRVVARYDLDPALDRLADVVREAVDMGHIYSVLGLSPKGR
RQT