Protein Info for DVU0807 in Desulfovibrio vulgaris Hildenborough JW710

Name: trmU
Annotation: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 1 to 341 (341 residues), 276.5 bits, see alignment E=1.4e-86 PF03054: tRNA_Me_trans" amino acids 1 to 190 (190 residues), 177.4 bits, see alignment E=4.5e-56 PF20259: tRNA_Me_trans_M" amino acids 197 to 259 (63 residues), 63.9 bits, see alignment E=1.2e-21 PF20258: tRNA_Me_trans_C" amino acids 269 to 341 (73 residues), 42.2 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 100% identical to MNMA_DESVH: tRNA-specific 2-thiouridylase MnmA (mnmA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to dvl:Dvul_2170)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72DX2 at UniProt or InterPro

Protein Sequence (346 amino acids)

>DVU0807 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTIAVAMSGGTDSLFALVLLKEQGQQVCGLHARFIPPTGHDPVPDIRAMCDRLGVDLHVV
DLTEAFEEHVVRPFMEDYMVGRTPNPCARCNATMKFGLLADAAAHVGAVHLATGHYARLL
RHPRWGTVLQRGVDPAKDQSYFLSLVPHARLEKAVFPLGNWRKEAVRGELARRSIVPPLP
SESQEICFVPDDDYRAFLKDRRVRLPGPGPIVTTRGRKIGSHAGLWQYTEGQRKGLGIAW
HEPLYVVGKDMENNMLLVGGREALASPGCVAEEVNLLVPYEDWPAEVAVRIRYRQQPLSA
RVTLRDGRLYARFREPQPPAARGQVLAVYDMEHHVLGGGVILGPLP