Protein Info for DVU0765 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hydroxypyruvate reductase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13660: DUF4147
  • amino acids 9 to 246 (238 residues), 275 bits, E=5.2e-86
• PF05161: MOFRL
  • amino acids 329 to 434 (106 residues), 130.4 bits, E=3.1e-42

Best Hits

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 100% identity to dvl:Dvul_2205)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

• L-serine biosynthesis II (3/4 steps found)
• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Sequence Analysis Tools

See Q72E14 at UniProt or InterPro

Protein Sequence (454 amino acids)

>DVU0765 hydroxypyruvate reductase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTPEQRSVLNDIIGAALGAVAPDRAVHRHVRRNDETLYIGDVPYDLAGYERILVVGAGKG
AAPMAHALEGVLGDRLDGGLVIVKYGHTMPLRRVRLREAAHPVPDAAGERAAHDVLDLVA
QTTERDLVLCVLTGGASALTPALCDGISLDDMRTATRLLLECGATIHEVNALRKHVSAFG
GGNLARRAAPARTASLIISDVVGDDLDVIASGPTAPDASTYADCHGIVTRYGIGTRLPAS
IRRRLEDGLAGHAPETPKPGDPLFDHVQNRLVATNRQALEAAATAARARGYIPRILTDSM
TGEARHKASELVDEAFRTADTFVCAEGPCCLLAGGETTVTLRGDGTGGRNQEMALAAAIA
LDGADHIAMLCLGTDGSDGPTDAAGGFASGLTLRTARERGLDPHRHLDDNNAYPFLEGTG
CLLRTGPTLTNVMDITAVLVDAPHTMPMRPDGDA