Protein Info for DVU0755 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 PF02518: HATPase_c" amino acids 334 to 450 (117 residues), 57.5 bits, see alignment E=8.6e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2216)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E24 at UniProt or InterPro

Protein Sequence (455 amino acids)

>DVU0755 sensor histidine kinase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSLTEQGRAITAQAAGYASVAERIGAKVSDYGSYGFSPRQTCALNVFFDLAQEFDSLED
LYSLAVLVLKQFFDLEAELYTLDPSGSLVRRSPDLGPTTATPPLPGELAEQPAFRDGEYR
IPVRGRSAERSSLPVTPVGDALGMLVVHPRQPLTDHQILYLQKYANRVGFQLHNKLMFFK
NREHIRFIRSLVHDIGHNVIVPNMYFKLLFRQLEGKIQSMSQVRETLLHGDCSSTNVLAE
AMHQLGYLHERLEEQYSEIYRHFQQSSMFLETLLRQSHFDQGHYVLQKSHIDLLQRVVLP
QVERFKGRLEEKGVKVCMPLYDDDTPRLVLADTGLISQVIANLLSNAVKYTRPDPDDESL
TMCCRIVFVENAFGEGKPAVRVEVCTSGPPVDAADVPHLFEPDFRGRNTTGEYGTGHGLH
FVREIVDLHGGHTGYHHDVCGNVFWFELPYSDPPS