Protein Info for DVU0752 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC transporter, amino acid-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 36 to 258 (223 residues), 208 bits, see alignment E=1.3e-65 PF09084: NMT1" amino acids 70 to 191 (122 residues), 31.7 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 100% identity to dvl:Dvul_2218)

Predicted SEED Role

"amino acid ABC transporter, amino acid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E27 at UniProt or InterPro

Protein Sequence (275 amino acids)

>DVU0752 amino acid ABC transporter, amino acid-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRLGKIIALAAAFLVFTGSAALAGPAYDNVMKDKKIRVGLMTDSIPGGFYNEKGEWGGFD
YDIATEIAKRMGVDIERVQVNNKTRIAYVQQGRVDISVSNMTHTRERDKSVDFSITYFFD
GQKVLAKKGQFKSVKDMVGKKIATMQGTTSEVNVKRALKEAGDPNPDQSVISFQKESECF
QALQMGRVAGWSTDASILVGYSAKEPGKFELVGNFLAEEPYGIAMPQDDSALRDAVNAAL
QDMWKDGTYKTIYNKWYGPGTPFEMPLAGQIEMWP