Protein Info for DVU0723 in Desulfovibrio vulgaris Hildenborough JW710
Name: purT
Annotation: phosphoribosylglycinamide formyltransferase 2 (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PURT_DESVH: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)
KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 100% identity to dvu:DVU0723)MetaCyc: 65% identical to phosphoribosylglycinamide formyltransferase 2 (Escherichia coli K-12 substr. MG1655)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]; Acetate kinase. [EC: 6.3.1.21, 2.7.2.1, 2.7.2.15]
Predicted SEED Role
"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
- Bifidobacterium shunt (13/15 steps found)
- superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
- 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
- 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
- lactate fermentation to acetate, CO2 and hydrogen (Desulfovibrionales) (7/8 steps found)
- pyruvate fermentation to acetate and lactate II (4/4 steps found)
- pyruvate fermentation to acetate I (3/3 steps found)
- pyruvate fermentation to acetate IV (3/3 steps found)
- pyruvate fermentation to acetate VII (3/3 steps found)
- superpathway of acetate utilization and formation (3/3 steps found)
- L-threonine degradation I (5/6 steps found)
- acetate and ATP formation from acetyl-CoA I (2/2 steps found)
- tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
- mixed acid fermentation (12/16 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- ethanolamine utilization (4/5 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
- superpathway of L-threonine metabolism (13/18 steps found)
- pyruvate fermentation to acetate II (2/3 steps found)
- glycine degradation (reductive Stickland reaction) (1/2 steps found)
- reductive glycine pathway of autotrophic CO2 fixation (6/9 steps found)
- (S)-propane-1,2-diol degradation (3/5 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (8/12 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- purine nucleobases degradation II (anaerobic) (16/24 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- methanogenesis from acetate (2/6 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
- superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
- acetyl-CoA fermentation to butanoate (2/7 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- L-lysine fermentation to acetate and butanoate (2/10 steps found)
- purine nucleobases degradation I (anaerobic) (5/15 steps found)
- gallate degradation III (anaerobic) (2/11 steps found)
- superpathway of methanogenesis (2/21 steps found)
- superpathway of L-lysine degradation (5/43 steps found)
KEGG Metabolic Maps
- Nucleotide sugars metabolism
- One carbon pool by folate
- Propanoate metabolism
- Purine metabolism
- Pyruvate metabolism
- Taurine and hypotaurine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.1.2.2, 2.7.2.1
Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 2.7.2.1 or 2.7.2.15 or 6.3.1.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q72E56 at UniProt or InterPro
Protein Sequence (393 amino acids)
>DVU0723 phosphoribosylglycinamide formyltransferase 2 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MASIGTPLTPTATRILLLGSGELGREVALEAMRLGVEVVAVDRYPNAPAMQVAHRSHVVS MLDGAALRAIIEAEKPYCIVPEIEAIATGTLLELEQEGYRVVPTARAARLTMDREGIRRL AAEELGLPTSPYRFASTEEEYRAAIETVGLPCVVKPVMSSSGKGQSLVRTPADIDSAWAY AQTGGRAGAGRVIVEGFVDFDYEITLLTVRHAGGVTFCDPIGHLQKDGDYRESWQPQPMD AVALEKARAMADAVTGALGGWGIFGVELFVRGDEVWFSEVSPRPHDTGLVTLISQNMSEF ALHVRAILGLPVPLLRQNGPAASCVILAEGDSEAPRFHGVDAALAEQDTALCLFGKPEVH GRRRMGVALALGDDIDAARAKARRAAGSVTVEL