Protein Info for DVU0712 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: amino acid ABC transporter, periplasmic-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 27 to 370 (344 residues), 192 bits, see alignment E=3.6e-60 PF13433: Peripla_BP_5" amino acids 28 to 109 (82 residues), 45.1 bits, see alignment E=1.2e-15 PF01094: ANF_receptor" amino acids 55 to 367 (313 residues), 105.8 bits, see alignment E=3.9e-34

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to dvu:DVU0712)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E67 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DVU0712 amino acid ABC transporter, periplasmic-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKGVVRLLAVCMVTSLLMAATAFAAGPVRVGLMCPLTGKWASEGQDMRNIVELLAEEVNK
AGGINGNKVELIVEDDGGDPRTAALAAQKLSTSGVTAVIGTYGSAVTEASQNIYDEAGIA
QIATGSTNVRLTEKGLKLFLRTCPRDDEQGRVAAKVIKNKGYKAVALLHDNSSYAKGLAD
ETKALLDKDGTKIVFYDALTPGERDYTAILTKLKAANPDIIFFTGYYPEVGMLLRQKMEM
KWNVPMMGGDAANNLDLVKIAGKAAAKGYFFLSPPVPQDFDTAEAKAFLAAYKAKHNALP
NSVWSVLAGDAFKVIVEAVQKGGKADGAGIATYLKTQLKNYPGLSGQISFNEKGDRVGDL
YRVYDVNAEGEFVLQR