Protein Info for DVU0706 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 14 to 14 (1 residues), see Phobius details transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details PF04290: DctQ" amino acids 23 to 152 (130 residues), 103.3 bits, see alignment E=4.9e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2258)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72E73 at UniProt or InterPro

Protein Sequence (156 amino acids)

>DVU0706 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEPTKKQPARIERALAALVMAALTLITGANVVMRYCTNVSFAMTEEVSVFLLMVLTLVGA
VSAFAEGRHVRITLFVNSLPDTGRKVCNALAWMCNVAMFGMLTWLAALVAWDDYSFEVTS
PALGVPQWWYSGWLPLAAAVIVLRLVLMLFQRRGKA