Protein Info for DVU0698 in Desulfovibrio vulgaris Hildenborough JW710

Name: rfbC
Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01221: dTDP-4-dehydrorhamnose 3,5-epimerase
  • amino acids 3 to 176 (174 residues), 208.2 bits, E=4e-66
• PF00908: dTDP_sugar_isom
  • amino acids 5 to 175 (171 residues), 219.4 bits, E=1.3e-69

Best Hits

Swiss-Prot: 43% identical to RMLC_SHIFL: dTDP-4-dehydrorhamnose 3,5-epimerase (rfbC) from Shigella flexneri

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 100% identity to dvl:Dvul_2266)

MetaCyc: 44% identical to dTDP-4-dehydrorhamnose 3,5-epimerase (Escherichia coli K-12 substr. MG1655)
dTDP-4-dehydrorhamnose 3,5-epimerase. [EC: 5.1.3.13]

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

See Q72E80 at UniProt or InterPro

Protein Sequence (190 amino acids)

>DVU0698 dTDP-4-dehydrorhamnose 3,5-epimerase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHITETGLPGLRLLTPQAHRDERGFFLETYRESFFDTLTHGQRFVQDNHARSEDAGVLRG
LHFQLPPMTQAKLVWAVQGSIYDVAVDLREGSPTFGRWFGCTLTAASFQRIYVPRGFAHG
YMTLEPGTEVMYKVDAYYAPALEQGLPWNDPDIGITWPDMTPILSAKDQRHGTFRDFRTP
FSFTPDTEHA