Protein Info for SOA0106 in Shewanella oneidensis MR-1

Annotation: methyl-accepting chemotaxis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 193 to 214 (22 residues), see Phobius details PF02203: TarH" amino acids 1 to 150 (150 residues), 31.9 bits, see alignment E=2.5e-11 PF12729: 4HB_MCP_1" amino acids 4 to 187 (184 residues), 45.2 bits, see alignment E=1.7e-15 PF00672: HAMP" amino acids 213 to 265 (53 residues), 33.1 bits, see alignment 1.2e-11 PF00015: MCPsignal" amino acids 329 to 510 (182 residues), 145.7 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to son:SO_A0106)

Predicted SEED Role

"methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E837 at UniProt or InterPro

Protein Sequence (546 amino acids)

>SOA0106 methyl-accepting chemotaxis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFKNMTLAQRLISVFFILSLLVLGVAWFSVVQLAGLHSNTTKITENLIPSIRSSAQMHIA
LLDARRNELNMVIDVMTHDSAAIEISKQRFETAKSEFEAGAQQYAKLNFVSEQDEQLFIK
LGEAAEKYFSAHSSLVSAIDQGDMASANIMIKTLTRQTLEVAGEETMNLRHENDRAAQEM
VLQSENAYKTAKMLSIIVGFSTIFFVVVMAFLLIRQIQNPIMWLLKQTHEVSAGNLTNKL
NMNAFARDEFGQLAESFNEMQDNLHMLVSEVSNSIVQLSSAAEEISSVALHSSNNMETQQ
NELNQLATAMHEMQATVQDVARNTNDAANAATQASDTATQGSETVNDSIVRIDKVAGAIE
ATAVVIRKLGDDSRNIGMVLEVIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRT
LAKRTQDSTSHINSIISELQLRANEAEETMQQSQEMMIETVCKAREAGESIAKISSSVSC
ISQMNIQIATATEEQGAVSEELNRNVANISGASEDVATGAKQMAMACNDLSHLATQLQDM
VKKFHI