Protein Info for SO4748 in Shewanella oneidensis MR-1

Name: atpG
Annotation: ATP synthase F1, gamma subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR01146: ATP synthase F1, gamma subunit" amino acids 1 to 286 (286 residues), 368.8 bits, see alignment E=1.3e-114 PF00231: ATP-synt" amino acids 4 to 286 (283 residues), 360.5 bits, see alignment E=4.3e-112

Best Hits

Swiss-Prot: 100% identical to ATPG_SHEON: ATP synthase gamma chain (atpG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02115, F-type H+-transporting ATPase subunit gamma [EC: 3.6.3.14] (inferred from 100% identity to son:SO_4748)

MetaCyc: 73% identical to ATP synthase F1 complex subunit gamma (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase gamma chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8B9 at UniProt or InterPro

Protein Sequence (286 amino acids)

>SO4748 ATP synthase F1, gamma subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MAGAKEIKTKIASVKNTQKITSAMEMVAASKMRRAQERMAASRPYAESMRKVIGHVAQGS
LEYKHPYLEVREAKRVGYIVVATDRGLCGGLNVNLFKKVVADVKSWKEQGAEFEFCPIGA
RSVQFFKSFGGQVSAQASGLGDAPKLNDLIGTVQVMLEAYNEGKLDRLYVVFNKFVNTMT
QTPVIEQLLPLPKSEDDEVAHRWDYIYEPDPKALLDTLLVRYVESQVYQGVVENIASEQA
ARMVAMKAATDNAGTLIDDLQLVYNKARQAAITQELSEIVSGASAV