Protein Info for SO4727 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF13489: Methyltransf_23" amino acids 95 to 198 (104 residues), 59 bits, see alignment E=4.8e-20 PF08241: Methyltransf_11" amino acids 119 to 156 (38 residues), 22.9 bits, see alignment 1.1e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4727)

Predicted SEED Role

"Putative methyltransferase associated with DUF414"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8D8 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SO4727 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRRCPLCHSTQTHLLLQDKKRCFYICQTCWLTFADANSHLPPAAEKQRYGRSRIASKQRH
LSQFILPLLTQIQQQQNGSLTGLNFGRVLDQTSLETIESAGHTFKQYDPFFAPDHETLKQ
EYDFICCYRVFEHFQYPIKEWSLLTRLLKPGGWLAISTPLLIDLEGFAKWHYKNNLTHVS
FYQRQTFEYLASNSDFELLFAAKDLVLMQKTS