Protein Info for SO4677 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06293: Kdo
  • amino acids 33 to 243 (211 residues), 256.8 bits, E=2e-80
• PF01163: RIO1
  • amino acids 85 to 182 (98 residues), 23.8 bits, E=4.7e-09

Best Hits

Swiss-Prot: 42% identical to KDKA_HAEIE: 3-deoxy-D-manno-octulosonic acid kinase (kdkA) from Haemophilus influenzae (strain PittEE)

KEGG orthology group: K11211, 3-deoxy-D-manno-octulosonic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to son:SO_4677)

MetaCyc: 100% identical to 8-amino-3,8-dideoxy-D-manno-octulosonate kinase (Shewanella oneidensis MR-1)
RXN-16750 [EC: 2.7.1.166]

Predicted SEED Role

"3-deoxy-D-manno-octulosonic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

• Kdo transfer to lipid IV_A (Haemophilus) (1/2 steps found)
• Kdo8N transfer to lipid IV_A (1/2 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.166

Sequence Analysis Tools

See Q8E8I7 at UniProt or InterPro

Protein Sequence (250 amino acids)

>SO4677 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MNAQIKIINTANGYMALCQDTPEDITPAWFSVDFWREKSAVVGSSKGRYTTWFVAFEHSH
WVLRHYWRGGMMEKFSKDAYFYTGLENTRAMGELRLLDALYREQFAVPKPIAANIVRDGL
FYRADIIIERVDGAEDLVAKLTKGTMTQAQWHALGATIAQFHRRGVYHADLNAKNILWQP
QQTDSAQERFYLIDFDRGELKTPNAKWQKANLDRLLRSFNKEQGKQPTLAFTPANWAALL
EGYHAVVPKV