Protein Info for SO4666 in Shewanella oneidensis MR-1

Name: cytcB
Annotation: cytochrome c (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00034: Cytochrom_C" amino acids 34 to 106 (73 residues), 43.4 bits, see alignment E=7e-15 amino acids 121 to 207 (87 residues), 45.1 bits, see alignment E=2.1e-15 PF13442: Cytochrome_CBB3" amino acids 136 to 203 (68 residues), 26.5 bits, see alignment E=6.5e-10

Best Hits

Swiss-Prot: 43% identical to CYC4_AZOVI: Cytochrome c4 (cycA) from Azotobacter vinelandii

KEGG orthology group: None (inferred from 100% identity to son:SO_4666)

Predicted SEED Role

"Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8J8 at UniProt or InterPro

Protein Sequence (207 amino acids)

>SO4666 cytochrome c (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKLALALSVVVAAISSPAIAEGNAEAGKTKIIVCSACHGMDGNSMIDMYPKLAGQHATY
LQKQIHDFRSAAQSGGKDGRMDPIMSGMAMPLSDQDILDISAYFSTQKIQVAEVKDVPEL
GAKLYKGGDVSRGITACMACHGPDGKGAESAGFPALAGQHANYIKLQLTKFRDAGRHNDL
NGMMQDVAKKLNDSDIDALSKYLASLK