Protein Info for SO4631 in Shewanella oneidensis MR-1

Name: greB
Annotation: transcription elongation factor GreB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 TIGR01461: transcription elongation factor GreB" amino acids 3 to 156 (154 residues), 230.7 bits, see alignment E=3.1e-73 PF03449: GreA_GreB_N" amino acids 5 to 74 (70 residues), 74.5 bits, see alignment E=6.2e-25 PF01272: GreA_GreB" amino acids 81 to 155 (75 residues), 82.3 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 68% identical to GREB_VIBVU: Transcription elongation factor GreB (greB) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 100% identity to son:SO_4631)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8N1 at UniProt or InterPro

Protein Sequence (167 amino acids)

>SO4631 transcription elongation factor GreB (NCBI ptt file) (Shewanella oneidensis MR-1)
MKAHLITRQGWMTLDKELKYLWKEYRPQITLKVQEAAAQGDRSENADYTYNKRLLRQIDS
RVRYLVKRLEELKIVDYSPQQEGKIYFGAWFELENDAGERVRYRIVGKDELDTKLGYITI
DSPMARALIGKQVDDEVVVQTPSGPKAWYINEIRYTPFDAPLEGEHE