Protein Info for SO4575 in Shewanella oneidensis MR-1

Name: menC
Annotation: O-succinylbenzoate-CoA synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 TIGR01927: o-succinylbenzoate synthase" amino acids 83 to 343 (261 residues), 173 bits, see alignment E=4.7e-55 PF13378: MR_MLE_C" amino acids 176 to 327 (152 residues), 60 bits, see alignment E=2.8e-20

Best Hits

KEGG orthology group: K02549, O-succinylbenzoate synthase [EC: 4.2.1.113] (inferred from 100% identity to son:SO_4575)

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8T2 at UniProt or InterPro

Protein Sequence (374 amino acids)

>SO4575 O-succinylbenzoate-CoA synthase (NCBI ptt file) (Shewanella oneidensis MR-1)
MILTSLSLYLYRLPLDSFLPVGKQRIDHRKGLVLQAKATADGEVCDTEISNAEVTDSEVT
EGEVKESHVEIAPLSGFDIDQQPLSGFSRESLDEVQQALTVLLPKLQNQSIDCLLEQAEA
SPYPSIAFGLSLLHAKLSGKLDAVRPLTTAVPLIYQPTDAPKAELIAKIASLKPSVRSVK
VKVAQTSMEDELSLIYGILSQRPDLKLRLDANCGFSLEQALDFAACLPLDSIEYIEEPCQ
HPQDNHTLYRAIPLPYALDESLNDPDYQFVMHEGLTALIIKPMLLGSIEKLQRLIDEAHN
HGVRCILSSSLESSLGINDLAHLAAILTPDEIPGLDTLTAFSQDLLVPSGKLQCLTLQCL
TLNQLERVASTVQD